HIV Peptide/Epitope Analysis Tool

This tool is designed to use determine the similarities and mutations on epitope sequences.The sequence will be searched against the HIV-1 subtypes A, B and C consensus and ancestral sequences.

You may want to add other subtypes reference sequences and/or vaccine strains using the load extra strains options.


A) Example Sequences (Copy and Paste the FASTA sequences)

>ENVB14_5220
ERYLRDQQL
>ENVB7_52625
IPRRIRQGL

B) Strains sequences examples

>A.CD.97.KCC2_AJ401034
MIVRGIQRNSQHLWTWGTLIFWTIIICSAAEELWVTVYYGVPVWKDAETTLFCASHANAYEKEQHI
VWATHACVPTDPNPLEMDLDNVTEEFNMWKNNMVEQIHDDIIRLWDRSLQPRVKLTPLCVTLDCQP
VNSTNNTKVEVPGEMTNCSFNMTTELSDKKQKVRSLFYRIDLVQIGNNTNDSSNRSLQYRLINCNT
STITQACPKVSFEPVPIHYCAPAGFAILKCKDQEFNGTGPCKNVSTVQCTHGIKPVVSTQLLLNGS
LAEGGIKIRSANISYNAKNIIVQLDIPVKINCSRPNNNTRTSVRIGPGQTFYATGDIIGNIRQAHC
NLSRTAWNDTLYNVSKALREHFPNKTIIFNKSSGGDLEVTQHMFICGGEFFYCNTSGLFNSSWAPN
GSWINNIGSRENDTMTLPCRIKQIINMWQRVEQAMYAPPIKGNITCVSNITGLLLTRDGGTNETRE
NETFRPIGGEMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVEGREKRAVGMGAFFLGFLGAAGST
MGAASITLTVQARQLLAGIVQQQSNLLKAIEAQQHLLRLTVWGIKQLQARVLAVERYLKDQQLLGI
WGCSGKLICTTTVPWNSSWSNKSQDEIWNNMTWMQWDKEINNYTEIIYGLIEESQKQQEKNEFELL
ELDKWANLWNWFEISNWLWYIKIFIMIVGGLIGLRIVFAVLSIVNRVRQGYSPLSFQTPIPSPEGP
DRPGRIEEGGGEQGRTRSIRLVSGFLELAWDDLRSLCLFVYHRSRDFILIAARTVELLGHSSLKGL
RLGWEGLKYLWNLLVYWSQELKTSAVSAFNALAITVAEWTDRAIEVGQRIGRGILNIPRRIRQGFE
RALL

Tool Information?

submit sequences
example sequences

Problems, questions and suggestions please contact:
Tulio de Oliveira or Heikki Lehvaslaiho
, South African National Bioinformatics Institute, University of Western Cape, South Africa.


Page last updated by Tulio de Oliveira.